3.18 Rating by CuteStat

audiclubtr.com is 6 years 1 week old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, audiclubtr.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

94.199.200.87

Hosted Country:

Türkiye TR

Location Latitude:

41.0484

Location Longitude:

29.0156
vBulletin 4.2.0 Install System

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 94.199.200.87)

Amargi Dergi | 3 aylık Feminist Dergi

- amargidergi.com
9,446,032 $ 240.00

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Index of /

- mersindoguakdeniztemsilciligi.com
Not Applicable $ 8.95

Özcanlar Mermer Granit | Yapı Malzemeleri

- ozcanlarmermergranit.com

Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi

Not Applicable $ 8.95

Twins Park Residence

- twinsparkresidence.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
X-Powered-By: PHP/7.2.5
Content-Type: text/html; charset=UTF-8
Content-Length: 4298
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Sat, 05 May 2018 04:42:10 GMT
Accept-Ranges: bytes
Connection: close

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: May 3, 2018, 12:00 AM 6 years 1 week 6 days ago
Last Modified: May 3, 2018, 12:00 AM 6 years 1 week 6 days ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
cpns1.turhost.com 37.230.110.110 Türkiye Türkiye
cpns2.turhost.com 37.230.111.111 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
audiclubtr.com A 14400 IP: 94.199.200.87
audiclubtr.com NS 86400 Target: cpns2.turdns.com
audiclubtr.com NS 86400 Target: cpns1.turdns.com
audiclubtr.com SOA 86400 MNAME: cpns1.turdns.com
RNAME: csf.ofis.net
Serial: 2018050303
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
audiclubtr.com MX 14400 Target: audiclubtr.com
audiclubtr.com TXT 14400 TXT: v=spf1 +a +mx +ip4:94.199.200.85 ~all

Full WHOIS Lookup

Domain Name: AUDICLUBTR.COM
Registry Domain ID: 2259521280_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-05-03T06:13:44Z
Creation Date: 2018-05-03T06:11:32Z
Registry Expiry Date: 2019-05-03T06:11:32Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: CPNS1.TURHOST.COM
Name Server: CPNS2.TURHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-05T04:41:56Z